pushery/matomo-analytics-for-laravel
Privacy-first Matomo analytics for Laravel with cookieless tracking, reports, Web Vitals, batching and bot filtering.
Maintainers
Package info
github.com/pushery/matomo-analytics-for-laravel
pkg:composer/pushery/matomo-analytics-for-laravel
Requires
- php: ^8.4
- ext-json: *
- illuminate/bus: ^12.0 || ^13.0
- illuminate/contracts: ^12.0 || ^13.0
- illuminate/http: ^12.0 || ^13.0
- illuminate/queue: ^12.0 || ^13.0
- illuminate/support: ^12.0 || ^13.0
Requires (Dev)
- larastan/larastan: ^3.0
- laravel/pint: ^1.0
- matomo/device-detector: ^6.4
- orchestra/testbench: ^10.0 || ^11.0
- pestphp/pest: ^4.0
- pestphp/pest-plugin-browser: ^4.3
- pestphp/pest-plugin-laravel: ^4.0
- pestphp/pest-plugin-type-coverage: ^4.0
- rector/rector: ^2.0
- spaze/phpstan-disallowed-calls: ^4.12
Suggests
- matomo/device-detector: Exhaustive, upstream-maintained bot detection across every category — wire DeviceDetectorBotDetector through the bots.detector config hook.
- matomo/matomo-php-tracker: Use the official server-side Matomo tracker instead of the bundled thin HTTP client
Provides
None
Conflicts
None
Replaces
None
MIT 8238a2e2cbd43c6393fbd1c6ef8a817607477edc
analyticspiwiklaraveltrackingprivacycookielessgdprmatomoweb-analyticsbot-detectionreporting-apiweb-vitals
This package is auto-updated.
Last update: 2026-06-25 14:45:54 UTC
README
👁 Matomo Analytics for Laravel
Matomo Analytics for Laravel
👁 Latest Version
👁 PHP Version
👁 PHPStan
👁 Code Style
👁 License
Privacy-first Matomo tracking for Laravel — client and server, single or batched, with AI-bot detection, env-driven tracking gates, and fail-safe delivery that never blocks your app. Works the same for self-hosted Matomo and Matomo Cloud.
Requirements
- PHP 8.4+
- Laravel 12 or 13
Installation
composer require pushery/matomo-analytics-for-laravel php artisan matomo:install
The service provider is registered automatically. matomo:install publishes
config/matomo-analytics.php (every option is documented inline).
Then set your instance in .env:
MATOMO_HOST=https://your-instance.matomo.cloud # or https://analytics.example.com MATOMO_SITE_ID=1 MATOMO_TOKEN= # optional; see "Server-side identity" # MATOMO_MODE=batch # switch single -> batch transmission
Tracking is a no-op until MATOMO_HOST and MATOMO_SITE_ID are set, so it stays
inert in local and CI environments. Verify connectivity any time:
php artisan matomo:test
Matomo Cloud
Cloud and self-hosted use the same code path — only the host differs. Point
MATOMO_HOST at your Cloud subdomain and everything (tracking …/matomo.php,
Reporting API …/index.php, the JS tracker …/matomo.js, opt-out, no-script pixel)
is derived from it:
MATOMO_HOST=https://your-instance.matomo.cloud MATOMO_SITE_ID=1 MATOMO_TOKEN=your-cloud-auth-token # Cloud UI → Personal → Security → Auth tokens
- Set a token. Matomo only honours the real visitor IP (
cip), exact hit time (cdt), and geolocation when atoken_authis sent — so for correct server-side attribution on Cloud,MATOMO_TOKENis effectively required (use a dedicated tracking token). Without it, hits are attributed to your app server's IP. - Plan limits. Cloud bills by hits and is more likely to throttle the Reporting API than tracking. This package already batches/bulk-sends and caches reports with date-aware TTLs, so you stay well within limits.
- Optional CDN for the JS. Cloud can also serve
matomo.jsfrom its CDN. SetMATOMO_JS_HOSTto load the asset from there while tracking stays on your subdomain:MATOMO_JS_HOST=https://cdn.matomo.cloud/your-instance.matomo.cloud
Verify Cloud end-to-end (the definitive check) with the built-in commands:
php artisan matomo:test # sends a real hit, reports the HTTP status php artisan matomo:report VisitsSummary.get # confirms the Reporting API against Cloud
Server-side tracking
Track from anywhere via the Matomo facade. Hits are gathered during the request
and delivered out of band, so they never block the response.
use MatomoAnalytics\Facades\Matomo; Matomo::pageView('Pricing'); Matomo::event('Subscription', 'created', 'pro', 49.00); Matomo::siteSearch('invoices', category: 'docs', count: 7); Matomo::goal(3, revenue: 49.00); Matomo::download('https://example.com/whitepaper.pdf'); Matomo::outlink('https://partner.example.com'); Matomo::ping();
Automatic page views
Attach the middleware to track page views without any per-route code:
// routes/web.php Route::middleware('matomo.track')->group(function () { // ... });
Or register it on the whole web group by setting middleware.auto to true.
It records only successful full-page GET responses (Livewire updates and
non-2xx responses are skipped) and resolves the page title from the response.
Server-side identity
When a MATOMO_TOKEN (a tracking-scoped token_auth) is configured, the package
forwards the real client IP (cip) and the exact hit time (cdt) — Matomo only
honours those with a token. Visitors are identified cookielessly by default via a
daily-rotating, salted hash; authenticated users are attached as the Matomo
User ID.
Client-side tracking
Render the JavaScript tracker in your layout:
<head> {{-- ... --}} @matomoScript </head>
It emits the cookieless _paq snippet (no consent banner required), auto-enables
link tracking and a heart-beat timer, and adds a <noscript> fallback pixel. Pass
a Content-Security-Policy nonce when you use one:
@matomoScript($cspNonce)
Set js.tag_manager to a container URL to load Matomo Tag Manager instead. Offer
a one-click opt-out anywhere:
@matomoOptOut
SPA / soft navigation
Single-page navigations never reload the document, so they're invisible to the normal
page view. Enable spa.enabled and the tracker records a virtual page view on each
client-side navigation. Choose the adapters your app uses:
'spa' => [ 'enabled' => env('MATOMO_SPA', true), 'adapters' => ['livewire', 'inertia'], // livewire | inertia | generic ],
livewire— Livewire and WireKitwire:navigate(listens forlivewire:navigated).inertia— Inertia.js, covering both Vue and React (listens forinertia:navigate).generic— any client-side router, via HistorypushState+popstate.
A window.matomoTrackPageView() helper is always exposed for manual or custom triggers.
(Matomo Tag Manager handles SPA navigation itself, so this only applies to the direct tracker.)
Web Vitals
Opt in (web_vitals.enabled) to capture Core Web Vitals. Drop the directive into your
layout — it beacons LCP/CLS/INP to a server-side route that records each as a Matomo
event through the normal gate:
@matomoWebVitals
It expects Google's web-vitals library on
window.webVitals — bundle it with your assets, or point web_vitals.library at a
self-hosted copy. No third-party CDN is loaded by default, and the snippet is a clean
no-op if the library isn't present.
Ecommerce
Track product views, the cart, and completed orders server-side — all fail-safe and gated like every other hit:
use MatomoAnalytics\Facades\Matomo; use MatomoAnalytics\Tracking\EcommerceItem; // A product (or category-only) view Matomo::ecommerceView(sku: 'TSHIRT-01', name: 'T-Shirt', category: 'Apparel', price: 29.90); // The cart changed — send its current contents and grand total Matomo::ecommerceCartUpdate(grandTotal: 59.80, items: [ new EcommerceItem('TSHIRT-01', 'T-Shirt', 'Apparel', 29.90, quantity: 2), ]); // A completed order Matomo::ecommerceOrder( orderId: 'ORDER-1001', grandTotal: 59.80, items: [new EcommerceItem('TSHIRT-01', 'T-Shirt', 'Apparel', 29.90, quantity: 2)], subTotal: 50.00, tax: 9.80, shipping: 0.00, discount: 0.00, );
Site search
Beyond Matomo::siteSearch($keyword, $category, $count), track straight from the request:
Matomo::searchFromRequest(keywordKey: 'q', categoryKey: 'category', count: $results->total()); // No-result searches are valuable — track them with a count of zero Matomo::siteSearch($keyword, count: 0);
Or auto-track every search on a route with the middleware (result count isn't known there):
Route::get('/search', SearchController::class)->middleware('matomo.search:q,category');
Reporting (read side)
Pull statistics back out of Matomo with the MatomoReports facade. It reuses your
host/site_id/token (a token with at least view access is required), POSTs the
token_auth in the request body (never the query string), caches results with
date-aware TTLs, and surfaces Matomo's error envelope through lastError():
use MatomoAnalytics\Facades\MatomoReports; $summary = MatomoReports::visitsSummary(['period' => 'day', 'date' => 'today']); $pages = MatomoReports::topPageUrls(['period' => 'month', 'date' => '2026-01']); // Anything not covered by a helper: $goals = MatomoReports::get('Goals.get', ['period' => 'week', 'date' => 'today']); // One round-trip for several methods (API.getBulkRequest): [$visits, $actions] = MatomoReports::bulk([ 'VisitsSummary.get', ['method' => 'Actions.get', 'period' => 'week'], ]); if ($summary === null) { report_to_user(MatomoReports::lastError()); // e.g. show a dashboard banner }
Curated helpers: visitsSummary, liveCounters, lastVisits, topPageUrls,
topPageTitles, siteSearchKeywords, topReferrers, referrerTypes, countries,
deviceTypes, browsers, goals, eventCategories. A failed call returns null
(never cached, so it retries next time) and is reported through the same throttled
alerting as tracking. Invalidate everything with MatomoReports::flushCache().
Transmission modes
Switch with MATOMO_MODE — no code changes:
| Mode | Behaviour |
|---|---|
queue (default) |
A request's hits are sent as one queued Bulk request on terminate. |
sync |
Sent immediately (handy for the CLI, tests, or very low volume). |
batch |
Hits are buffered across requests and flushed in large Bulk batches — the most resource-efficient option. |
In batch mode hits are stored in a buffer (database driver by default) and
drained by a scheduled matomo:flush (registered automatically; ensure your
scheduler runs). For the database driver, publish and run the migration:
php artisan vendor:publish --tag=matomo-analytics-migrations php artisan migrate
The queued worker must serve the matomo queue, e.g. php artisan queue:work --queue=matomo,default.
Scaling self-hosted Matomo (QueuedTracking)
The modes above control delivery on your app's side. On a busy self-hosted Matomo, also install Matomo's QueuedTracking plugin, which queues incoming hits on the Matomo server (Redis or MySQL) and processes them with a background worker — so the tracking endpoint answers in milliseconds instead of writing to the database on the request path. (Matomo Cloud already does this for you.)
The two layers compose and need no extra package configuration:
batchmode here sends fewer, larger Bulk requests; QueuedTracking accepts each instantly and writes asynchronously — the most efficient combination at high volume.- Because hits leave your app fast and QueuedTracking absorbs spikes, you get end-to-end backpressure without ever blocking a user response.
On the Matomo host, enable it and run its processor (e.g. a core:archive-style worker or
./console queuedtracking:process on a schedule) per the plugin's docs.
Who gets tracked
Tracking is governed by a single gate, configured under tracking:
'tracking' => [ 'environments' => ['production'], // restrict to environments (null = all) 'track_authenticated' => true, // include logged-in users 'except_abilities' => ['admin'], // skip users passing a Gate ability 'except_ips' => ['10.0.0.0/8'], // skip IPs / CIDR ranges 'except_routes' => ['horizon*', 'up'],// skip route/path patterns 'gate' => null, // invokable class-string for full control ],
Bots & AI crawlers
Bots and AI/LLM crawlers (GPTBot, ClaudeBot, PerplexityBot, Bytespider, …) are
detected and excluded by default. Detection is layered: an explicit allow/deny
list, a curated AI-crawler list (130+ tokens), generic crawler signals
(bot/crawler/spider/+http/… plus social link-preview agents), and an optional
custom detector. Set bots.track to true to record them instead.
The AI-crawler list moves fast, so it is kept current automatically: a scheduled
workflow regenerates it from the canonical ai.robots.txt
catalogue (and Cloudflare Radar when a token is configured) and opens a PR for review.
For exhaustive, always-current coverage of every category (search, social,
SEO/marketing, monitoring, …) without bloating the package, opt into the
matomo/device-detector backstop —
the same catalogue Matomo uses server-side:
composer require matomo/device-detector
// config/matomo-analytics.php 'bots' => [ 'detector' => \MatomoAnalytics\Bots\DeviceDetectorBotDetector::class, ],
Privacy
Cookieless by default, with Do-Not-Track/Sec-GPC honoured server-side. Choose
a consent posture under privacy.consent (none, cookie, or full) — the
client snippet emits the matching Matomo consent calls. A publishable
privacy-policy partial is included:
php artisan vendor:publish --tag=matomo-analytics-views
URL redaction is on by default: secrets and PII are stripped from tracked URLs
before they reach Matomo. Sensitive query parameters keep their key but lose their
value, and regex patterns can scrub anything else — configure under privacy.redact:
?token=abc123&page=2 -> ?token=REDACTED&page=2
Server-side opt-out: the tracking gate honours a first-party opt-out cookie (Matomo's own opt-out widget sets a cookie on the Matomo domain that server-side tracking can't see). Wire it to your own control:
use MatomoAnalytics\Privacy\OptOut; return back()->withCookie(OptOut::enable()); // stop tracking this browser return back()->withCookie(OptOut::disable()); // opt back in
GDPR data-subject requests
Handle "right to be forgotten" and access requests through Matomo's PrivacyManager
API. Identify a person with a segment (e.g. userId, visitIp) and erase or export
every matching visit. These operations are never cached and need an admin-access
token (the read/tracking token may not be enough).
use MatomoAnalytics\Facades\MatomoGdpr; MatomoGdpr::forget('userId==alice@example.com'); // erase; returns deletion counts MatomoGdpr::export('userId==alice@example.com'); // export the subject's data MatomoGdpr::findDataSubjects('visitIp==203.0.113.7'); // preview the matching visits
Or from the CLI — it previews the match count and asks before deleting:
php artisan matomo:forget "userId==alice@example.com" # confirm, then erase php artisan matomo:forget "userId==alice@example.com" --force # no prompt php artisan matomo:forget "userId==alice@example.com" --export # export instead php artisan matomo:forget "userId==alice@example.com" --site=all
A DataSubjectForgotten event (visit count + per-area deletion counts) fires on every
erasure, so you can keep an audit trail.
Fail-safe by design
Tracking never blocks a response and a tracking error never surfaces in your app.
Delivery is durable: queued jobs retry with escalating backoff and land in
failed_jobs if exhausted; the batch buffer keeps hits until a confirmed 200.
Alerts are throttled and raised only after a configurable number of attempts, so a
single timeout never pages your monitoring (resilience.reporting).
Nothing gets stuck or lost: a poison batch Matomo permanently rejects (HTTP 4xx) is
moved to a dead-letter table at once, and a batch that keeps failing transiently
is dead-lettered after batch.max_attempts — so one bad batch never blocks the queue.
Inspect and re-queue the dead-letter with matomo:replay --list and matomo:replay.
Laravel Octane
Octane-safe. Every request-stateful service (tracker, reporting, GDPR, the in-memory
buffer) is bound scoped, so a long-lived Octane worker resets them between requests and
never leaks one request's state into the next; only stateless services stay shared. This is
covered by tests that exercise Octane's between-request reset directly — no extra setup
needed on your side.
Events
Listen for TrackingQueued, TrackingSent, TrackingFailed,
VisitorExcluded, and DataSubjectForgotten to hook tracking into your own pipelines.
Testing
Swap in a fake and assert what would be tracked:
use MatomoAnalytics\Facades\Matomo; use MatomoAnalytics\Tracking\PageView; $fake = Matomo::fake(); $this->get('/pricing'); $fake->assertTracked(PageView::class);
For the read side, swap the reporting client and stub responses:
use MatomoAnalytics\Facades\MatomoReports; $reports = MatomoReports::fake(); $reports->stub('VisitsSummary.get', ['nb_visits' => 42]); // ... exercise code that calls MatomoReports ... $reports->assertRequested('VisitsSummary.get');
The GDPR tools fake the same way:
use MatomoAnalytics\Facades\MatomoGdpr; $gdpr = MatomoGdpr::fake()->stubFound([['idsite' => 1, 'idvisit' => 10]]); // ... exercise code that calls MatomoGdpr::forget() ... $gdpr->assertForgotten('userId==alice@example.com');
Console commands
| Command | Purpose |
|---|---|
matomo:install |
Publish the config and print setup hints. |
matomo:test |
Send a test hit and report connectivity. |
matomo:flush |
Drain the batch buffer (scheduled automatically in batch mode). |
matomo:work |
Long-running daemon that continuously drains the batch buffer. |
matomo:replay |
Re-queue dead-lettered hits into the buffer (--list, --limit, --prune). |
matomo:report |
Fetch a Reporting API method and print the JSON result. |
matomo:forget |
Erase or export a data subject's data for GDPR requests (--force, --export, --site). |
Security
Please review the security policy and report vulnerabilities privately rather than opening a public issue.
Built by Pushery
This package is built and maintained by Pushery — a Berlin-based studio building Laravel applications, SaaS products, and open-source tools.
Building a Laravel UI? WireKit, Pushery's open-source Livewire component kit, gives you a polished component library out of the box. Browse the rest of our work at pushery.com.
License
The MIT License (MIT). See LICENSE for details.
